PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000275713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 256aa    MW: 28439.4 Da    PI: 10.8364
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000275713genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY53.35.7e-17851261859
                    -SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  18 sefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    s+fprsYYrCt ++C+vkk+vers++dp++ +it eg+H h+
  MDP0000275713  85 SPFPRSYYRCTNTKCTVKKRVERSSQDPTTAIITCEGQHCHH 126
                    89*************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182909.81E-1385126IPR003657WRKY domain
PROSITE profilePS5081116.58185128IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-1485127IPR003657WRKY domain
SMARTSM007747.8E-985127IPR003657WRKY domain
PfamPF031062.6E-1185126IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MTASPASNPS PPPPTRPIWR ELLVVVLLFW ITTAAVAAPP LGAPTRPLLS DPLRPLRQCL  60
RAPARIRLRG LQAPVVNHHP RYRVSPFPRS YYRCTNTKCT VKKRVERSSQ DPTTAIITCE  120
GQHCHHTVAF PRGGVMGHEF GFMGHQLSQL PPASQFMYYP TIRPREITNP INLTPTLSHQ  180
LSVPSTSAGK MRRRLRHMHG VRETVDGEYE PREGVAGLQL LXLFLYKAQQ HVGSSLGNSA  240
SSSSQEDSNG SAFWPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389418.11e-100PREDICTED: probable WRKY transcription factor 57 isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108143140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-24WRKY DNA-binding protein 57